PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.16782s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 249aa    MW: 27665 Da    PI: 8.4762
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.16782s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.51.1e-261461055
               G2-like 10 LHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Araha.16782s0002.1.p  1 LHDRFVDAVAKLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRL 46
                          9********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.5E-18147IPR006447Myb domain, plants
SuperFamilySSF466899.32E-11149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-23148IPR009057Homeodomain-like
PROSITE profilePS5129411.463149IPR017930Myb domain
PfamPF002491.1E-5245IPR001005SANT/Myb domain
PfamPF143794.6E-1997141IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
LHDRFVDAVA KLGGADKATP KSVLKLMGLK GLTLYHLKSH LQKYRLGQQQ GKKQNRTEQN  60
KENAGSSYVH FDNCSQGGIS NESRFDSHQR QSGNVPFAEA MRHQVDAQQR FQEQLEVQKK  120
LQMRMEAQGK YLLTLLEKAQ QSIPCGNAGE TDKGQFSDFN LALSRLVGSD HKNQKAGLVA  180
NISHLNADSS EDFRLCGEQE KIETGDACVK PESGFVHFDL NSKSGYDLLN CGKYGIEVKP  240
NMIADRHQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0120030.0BT012003.1 Arabidopsis thaliana At5g45580 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002863468.11e-177hypothetical protein ARALYDRAFT_356449
TrEMBLD7MTE01e-177D7MTE0_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80002361e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124952530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-175G2-like family protein